X

About Us

PeptiCore is a global manufacturer and supplier of peptides and pharmaceutical raw materials in the chemical industry.
Our main products include peptide products and pharmaceutical raw materials. We boast strong R&D capabilities, superb synthesis technology, and advanced quality control methods. We actively promote joint ventures and cooperation with major enterprises and manufacturers, serving society and users with the concept of industrial development. We always adhere to market demand orientation and continuously develop new high-tech chemical products and pharmaceutical intermediates.

I am very confident in the quality of our products, and many foreign customers have given high praise after receiving our goods. Our products are of excellent quality, and we firmly guarantee door-to-door delivery of your orders.

Get a free quote

Contact Info

Welcome to Our Company

English 中文版

Top-Tier Peptide Solutions for Wellness & Beauty

Pharmaceutical-Grade Purity Fast Global Shipping Customizable Options & Competitive Pricing

Lab-Verified Peptides with Strict QC,
Delivering Consistent Results Trusted Worldwide

View More

00

k+

Reviews

Watch Video

PeptiCore

We deliver cross-industry supply solutions for multi-
purpose chemicals.

Deepening Ties with Old Clients, Welcoming New Clients Widely
Creates a Win-Win Future

View More

00

k+

Reviews

Watch Video

Quality First, Safety Guaranteed

Latest Products

View More
KPV

KPV

[Molecular formula] C16H30N4O4 [Molecular weight] 342.43 [Appearance] White powder [Purity] 99% [Function] 1. Accelerate wound healing and reduce infection; 2. Anti-inflammatory effect; 3. Antibacterial effect on pathogens; 4. Anti-tumor effect; 5. Can regulate intestinal flora and restore intestinal barrier function; About KPV peptide KPV peptide is a tripeptide composed of the amino acids lysine (K), proline (P) and valine (V). It is a naturally occurring peptide sequence found in various proteins and peptides in the body. The potential biological activities and therapeutic applications of KPV peptide have been studied. Some studies have shown that KPV may play a role in regulating inflammation and oxidative stress, promoting wound healing, and regulating blood pressure. In addition, its potential effects on cardiovascular health and neuroprotection have also been studied. Certificate ...

Read More
NAD

NAD

NAD, also known as nicotinamide adenine dinucleotide, is an essential bioactive molecule in our body. Its main functions include: 1. NAD has significant anti-aging effects. As we age, the level of NAD in the human body gradually decreases, leading to accelerated cellular aging. Supplementing with NAD can effectively activate anti-aging mechanisms, delay cellular aging, and keep our bodies young. 2. NAD is crucial for enhancing energy. It participates in the energy production process of cellular mitochondria, helping us maintain abundant physical energy. When NAD levels are sufficient, we feel energized and able to cope with various challenges in daily life. 3. NAD can also promote cell repair. In daily life, our bodies are inevitably damaged, and NAD can help repair damaged cells and tissues, promoting physical recovery. 4. NAD can also improve cognitive function. By activating relevant proteins in brain cells, NAD can enhance memory, thinking ability, and concentration, making our brain more flexible and sharp. ...

Read More
Semaglutide

Semaglutide

lt is a dual glucose-dependent insulinotropic polypeptide (GIPand glucagon-like peptide-1 (GLP-1) receptor agonist that is beingdeveloped for the treatment of type 2 diabetes. lt shows significantlybetter  efficacy with regard to glucose control. Thiscontent is provided strictly for research purposes and does not constitute anendorsement or  recommendation for the non-laboratoryapplication or improper handling of peptides designed for research. The information, including discussions about specific peptides and theirresearched benefits, is presented for informational purposes only and must notbe construed as health, clinical, or legal guidance, nor an encouragement fornon-research use in humans, Peptides described here are solely for use instructured scientific study by authorized individuals, Forresearch USE ONLY, Certificate ...

Read More
Retatrutide

Retatrutide

Sequence: Tyr-{Aib}-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile-{α-Me-Leu}-Leu-Asp-Lys-{doacod=C20-gamma-Glu-(AEEA)-Lys}-Ala-Gln-{Aib}-Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 Molecular Formula: C118H175N35O28 Molecular Weight: 2660.94 g/mol CAS Number: 2571941-83-5 PubChem CID: 145996114 Appearance: White powder Storage: Store in cool, dry and dark place，2-8°C Shelf Life: 2 Years Package: 5mg,10mg,15mg,1g,2g Certificate ...

Read More
BPC 157

BPC 157

Common Name BPC 157 Density 1.4±0.1 g/cm3 Boiling Point 1802.9±65.0 °C at 760 mmHg Molecular Formula C62H98N16O22 Molecular Weight 1419.536 Flash Point 1044.2±34.3 °C Exact Mass 1418.704102 LogP -2.41 Vapour Pressure 0.0±0.6 mmHg at 25°C Index of Refraction 1.576 Certificate ...

Read More
Tirz

Tirz

lt is a dual glucose-dependent insulinotropic polypeptide (GIPand glucagon-like peptide-1 (GLP-1) receptor agonist that is beingdeveloped for the treatment of type 2 diabetes. lt shows significantlybetter  efficacy with regard to glucose control. Thiscontent is provided strictly for research purposes and does not constitute anendorsement or  recommendation for the non-laboratoryapplication or improper handling of peptides designed for research. The information, including discussions about specific peptides and theirresearched benefits, is presented for informational purposes only and must notbe construed as health, clinical, or legal guidance, nor an encouragement fornon-research use in humans, Peptides described here are solely for use instructured scientific study by authorized individuals, Forresearch USE ONLY, Certificate ...

Read More
Cagrilintide

Cagrilintide

Cagrelinide is a a cyclic peptide composed of 38 amino acids, with a sequence containing 38 amino acids and a pair of disulfide bonds. Kaglirin can significantly reduce weight and reduce food intake. Kagrelin peptide has potential in obesity research. As a non selective amino acid receptor (AMYR) and calcium G protein coupled receptor (CTR) advocate, Cagrinide is a new long acting acetylated amino acid analysis, which is a cyclic peptide composed of 38 amino acids The sequence contains a pair of defective bonds Cagritide can significantly reduce weight and food intake Cagritide has potential in objectivity research. Name ： Cagrilintide CAS： 1415456-99-3 Form： Powder EINECS： 206-141-6 Appearance: Powder Purity: >99% (or refer to the Certificate of Analysis) Shipping Condition: Shipped under ambient temperature as non-hazardous chemical. This product is stable enough for a few weeks during ordinary shipping and time spent in Customs. Storage Condition: Dry, dark and at 0 - 4 C for short term (days to weeks) or -20 C for long term (months to years). Solubility: To be determined Shelf Life: >2 years if stored properly Stock Solution Storage: 0 - 4 C for short term (days to weeks), or -20 C for long ...

Read More
Lipo-C

Lipo-C

10 mL vial Amount per mL: Methionine 25mg Inositol 50mg Choline 50mg B6 (Pyridoxine) 25mg B5 (Dexpanthenol) 25mg B12 (Methylcobalamin)1mg  L-Carnitine 20mg L-Arginine 20mg 2% Benzyl Alcohol 2% Lidocaine  0.1% In sterile water 20 mL vial Amount per mL: Methionine 25mg Inositol 50mg Choline 50mg B1 (Thiamine HCL) 100 mg B6 (Pyridoxine) 25mg B5 (Dexpanthenol) 250 mg B12 (Methylcobalamin) 250 mcg L-Carnitine 600mg 2% Benzyl Alcohol 2% Lidocaine 0.1%" ...

Read More
GHK-CU

GHK-CU

GHK-CU Certificate ...

Read More
Tesamorelin 10mg

Tesamorelin 10mg

Tesamorelin, is a syntheitic peptide consiting of 44 amino acids. It is a growth-hormone-releasing hormone (GHRH) analogue researched for the treatment of HIV-associated lipodystrophy (dysfunctional, toxic fat deposition). It is also being researched for its ability to improve peripheral nerve health, slow the progression of mild cognitive impairment, and the reduction visceral fat. Certificate ...

Read More
TB 500

TB 500

1. TB500 fragment has been shown to have the ability to promote the formation of blood vessels and to help repair damaged tissues. It also has anti-inflammatory properties and may help to reduce swelling and pain. Additionally, TB500 fragment has been found to stimulate stem cell production, which can lead to enhanced tissue regeneration. 2. TB500 fragment has the potential to be highly effective in treating a range of medical conditions, including chronic inflammation, heart disease, and skin wounds. It has also been found to be effective in reducing the severity of cardiovascular diseases, such as myocardial infarction and myocarditis. 3.TB500 is a synthetic version of an active region of thymosin β4. TB500 is claimed to promote endothelial cell differentiation, angiogenesis in dermal tissues, keratinocyte migration, collagen deposition and decrease inflammation. Certificate ...

Read More
PT 141

PT 141

PT 141, also known as Bremelanotide, is a synthetic peptide developed for its unique properties related to sexual health and arousal. Originally derived from the peptide hormone Melanotan II, PT 141 is specifically designed to enhance libido in both men and women. Unlike other treatments that target the vascular system, PT 141 works directly through the nervous system, making it a distinct option for those seeking an alternative approach to sexual dysfunction. Certificate ...

Read More
AOD9604

AOD9604

AOD 9604, also known as Anti-Obesity Drug 9604, is a synthetic peptide fragment derived from human growth hormone (HGH). Specifically, it consists of amino acids 176-191 of the C-terminus of the HGH molecule. This peptide has been extensively studied for its potential to promote weight loss and improve metabolic health. ...

Read More
HCG

HCG

Human Chorionic Gonadotropin (HCG) is a naturally occurring peptide hormone predominantly produced during pregnancy by the placenta. It plays a crucial role in maintaining the corpus luteum during the beginning of pregnancy and is often used in fertility treatments. However, HCG has garnered attention for its potential benefits in weight loss and body composition improvement. Certificate ...

Read More
Thymosin Alpha-1 10mg

Thymosin Alpha-1 10mg

Thymosin Alpha-1 (Tα1) is a synthetic version of a naturally occurring thymic peptide, which plays a crucial role in modulating the immune system. Initially isolated from thymus gland tissue, this peptide has been extensively studied for its immunomodulatory and therapeutic properties. It is composed of 28 amino acids, making it a relatively small peptide with significant biological activity. Certificate ...

Read More
CJC-1295 With DAC

CJC-1295 With DAC

Name GLP-1 peptides Purity 99.9% Package 10vials/kit storage cool and dry Certificate ...

Read More
SS-31

SS-31

Items Specifications CAS No. 736992-21-5 MF C32H49N9O5 MW 639.79 EINECS No. 205-858-1 Density 1.34±0.1 g/cm3(Predicted) Sequence H-d-Arg-dimethylTyr-Lys-Phe-NH2 Appearance white powder Shelf Life 2 Years When Properly Stored Storage Keep in a cool, dry, dark location in a tightly sealed container or cylinder. Certificate ...

Read More
Sermorelin

Sermorelin

Sermorelin, a synthetic peptide comprising 29 amino acids, is designed to mimic the natural growth hormone-releasing hormone (GHRH) produced by the human hypothalamus. It stimulates the pituitary gland to release growth hormone (GH), which subsequently triggers various physiological processes, including cell growth, cell regeneration, and metabolism. Certificate ...

Read More
Ipamorelin

Ipamorelin

Ipamorelin is a pentapeptide composed of five amino acids that mimic the action of ghrelin, a hormone that stimulates the release of growth hormone (GH) from the pituitary gland. It is known for its potent growth hormone-releasing properties, which makes it popular in the fields of anti-aging and bodybuilding. However, one of the most sought-after benefits of Ipamorelin is its potential role in weight loss. Certificate ...

Read More
MOTS-c

MOTS-c

Items Specifications Product Name MOTS-C CAS number 1627580-64-6 Purity 99% Molecular Weight 2174.62 Molecular Formula C101h152n28o22s2 Application Weight loss Appearance White Lyophilized powder Reconstitution Required Storage After reconstitution store at 2°C - 8°C Certificate ...

Read More
Glutathione 1500mg*10vials

Glutathione 1500mg*10vials

Items Specifications Product Name Glutathione CAS No. C70-18-8 Formula C10H17N3O6S Molecular Weight 307.32348 EINECS 200-725-4 Density 1.441 Boiling Point Boiling Point Melting Point 182-192℃ Appearance powder Storage Conditions in a cool and dry place, away from direct sunlight ...

Read More
bac.water for peptide

bac.water for peptide

There are 3 kinds of water, when you order, please notify which one you need. 1.Phosphate buffered saline or PBS solution is a combination of water and salts. It is a non-toxic solution used in many laboratories. Standard PBS usually is composed of sodium chloride, potassium chloride, potassium dihydrogen phosphate, and disodium hydrogen phosphate. 2.Bacteriostatic saline water is a physiological saline solution containing the bacteriostatic agent benzyl alcohol as a 0.9% solution. 3.  Bacteriostatic Acetic Acid is 0.6% AR Grade Glacial Acetic Acid in water that has been made to inhibit the growth of most types of bacteria. It is comprised of sterile and filtered water, with all bacteria removed, which is then mixed with 0.6% AR Grade Glacial Acetic Acid, and 0.9% benzyl alcohol, which prevents any contaminating bacteria from growing in the solution. ...

Read More
Epithalon

Epithalon

Epithalon is a peptide used to regulate the cell cycle through up-regulation of telomerase activity. The sequence of amino acids in the peptide is Alanine-Glutamate-Asparagine-Glycine. Animal studies have been done on the effects of Epithalon on suppression of spontaneous mammary tumors and spontaneous carcinogenesis. Product Name : Epitalon Other Names Epithalon or Epithalone Sequence: Ala-Glu-Asp-Gly CAS No. 307297-39-8 M.F. 390.0 Purity: 99.0% Appearance ：White powder Specification size: 5mg, 10mg ...

Read More
KissPeptin-10

KissPeptin-10

Kisspeptin, also known as metastin, is a naturally occurring protein in humans with crucial functions in hormone signaling during puberty and reproduction. Beyond its role in these processes, it is believed to impact mood and behavior, facilitate angiogenesis, and regulate kidney function. Furthermore, kisspeptin has been identified in the brain, where it demonstrates the ability to suppress tumor growth and metastasis (spread). However, the peptide garners the greatest scientific interest due to its notable influence on gonadotropin-releasing hormone (GnRH). ...

Read More
hyaluronic acid peptide

hyaluronic acid peptide

Items Specifications Product Name Hyaluronic Acid Powder Cas No 9004-61-9 Einecs 232-678-0 MF C14H22NNaO11 MW 403.31 Melting Point >209°C (dec.) Appearance White powder Shelf Life 2 Years When Properly Stored Storage Keep in a cool, dry, dark location in a tightly sealed container or cylinder. ...

Read More
Snap-8

Snap-8

Product Name: Snap-8 Purity: >98% (or refer to the Certificate of Analysis) Shipping Condition: Shipped under ambient temperature as non-hazardous chemical. This product is stable enough for a few weeks during ordinary shipping and time spent in Customs. Storage Condition: Dry, dark and at 0 - 4 C for short term (days to weeks) or -20 C for long term (months to years). Solubility: To be determined Shelf Life: >2 years if stored properly Drug Formulation: To be determined Stock Solution Storage: 0 - 4 C for short term (days to weeks), or -20 C for long term (months). ...

Read More
FOXO4

FOXO4

OXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice. Appearance: Powder Purity: >99% (or refer to the Certificate of Analysis) Shipping Condition: Shipped under ambient temperature as non-hazardous chemical. This product is stable enough for a few weeks during ordinary shipping and time spent in Customs. Storage Condition: Dry, dark and at 0 - 4 C for short term (days to weeks) or -20 C for long term (months to years). Solubility: To be determined Shelf Life: >2 years if stored properly ...

Read More
NAD+

NAD+

Product name NAD+ CAS number 53-84-9 Purity ≥99% Appearance White Powder Application Longevity supplements Molecular Formula C21H27N7O14P2 Molecular Weight 663.43g/mol Reconstitution Required Storage After reconstitution store at 2°C - 8°C ...

Read More
Glow BPC 157 10mg+GHK-CU 50mg+TB500 10mg

Glow BPC 157 10mg+GHK-CU 50mg+TB500 10mg

BPC 157 10mg GHK-CU 50mg TB500 10mg  Certificate ...

Read More
Follistatin

Follistatin

Follistatin is studied for its role in regulation of muscle growth in mice, also known as GDF-8, a TGF super family member which inhibits excessive muscle growth ...

Read More
IGF-1LR3

IGF-1LR3

Items Specifications Product Name IGF-1LR3 Other Names CL281;LR3-IGF1;IDF-1 LR3;IGF LR3-1;IGF-1 LR3;IGF-1Lr3 Igtropin;LR3-IGF1 (100mcg/vial;Recombinant Human Insulin-like Growth Factor-1 LR3, rhIGF-1 CAS 946870-92-4 Molecular Formula C50H69N15O9 Appearance White power CBNumber CB6947862 Storage Dry, dark and at 0 - 4 C for short term or -20 C for long term Purity ≥99% Certificate ...

Read More
LL37

LL37

The LL-37 precursor consists of a signal peptide, cathelin conserved region, and 37 amino acid residues that, when activated, are cleaved by serine protease 3 and other proteolytic enzymes to produce bioactive LL-37, which has antibacterial, antifungal, and antiviral functions, as well as chemotactic and immunostimulatory/regulatory effects. ...

Read More
Epithalon

Epithalon

Density 1.5±0.1 g/cm3 Boiling Point 959.8±65.0 °C at 760 mmHg Molecular Formula C14H22N4O9 Molecular Weight 390.346 Flash Point 534.3±34.3 °C Exact Mass 390.138672 LogP -2.02 Vapour Pressure 0.0±0.6 mmHg at 25°C Index of Refraction 1.559 Certificate ...

Read More
Semax

Semax

Product Specification: Items Specifications Product Name Semax CAS 80714-61-0 Molecular Weight 813.928 Molecular Formula C37H51N9O10S Appearance White Powder Packaging 10mg/vial, 10vials/box MOQ 10vials Certificate ...

Read More
Bodybuilding oil

Bodybuilding oil

Bodybuilding oil for resales! Welcome to contact with us for list sharing. ...

Read More
Tablets

Tablets

ALL PRODUCTS ARE EXCLUSIVELY INTENDED FOR LABORATORY RESEARCH AND DEVELOPMENTAL PURPOSES. THESE PRODUCTS ARE NOT INTENDED FOR HUMAN CONSUMPTION. If you need products, welcome to contact with us for list sharing. ...

Read More
About Us

What makes us different?

PeptiCore is a global manufacturer and supplier of peptides and pharmaceutical raw materials in the chemical industry.
Our main products include peptide products and pharmaceutical raw materials. We boast strong R&D capabilities, superb synthesis technology, and advanced quality control methods. We actively promote joint ventures and cooperation with major enterprises and manufacturers, serving society and users with the concept of industrial development. We always adhere to market demand orientation and continuously develop new high-tech chemical products and pharmaceutical intermediates.

I am very confident in the quality of our products, and many foreign customers have given high praise after receiving our goods. Our products are of excellent quality, and we firmly guarantee door-to-door delivery of your orders.

  • Unity

  • Strive

  • Innovation

  • Proactivity

READ MORE

  • 00

    +m2

    Plant Area

  • 00

    +

    Production Lines

  • 00

    +

    Employees

  • 00

    +

    Export Countries

Featured Products

Quality First Safety Guaranteed

KPV

Peptide

Hot
product

KPV

[Molecular formula] C16H30N4O4 [Molecular weight] 342.43 [Appearance] White powder [Purity] 99% [Function] 1. Accelerate wound healing and reduce infection; 2. Anti-inflammatory effect; 3. Antibacterial effect on pathogens; 4. Anti-tumor effect; 5. Can regulate intestinal flora and restore intestinal barrier function; About KPV peptide KPV peptide is a tripeptide composed of the amino acids lysine (K), proline (P) and valine (V). It is a naturally occurring peptide sequence found in various proteins and peptides in the body. The potential biological activities and therapeutic applications of KPV peptide have been studied. Some studies have shown that KPV may play a role in regulating inflammation and oxidative stress, promoting wound healing, and regulating blood pressure. In addition, its potential effects on cardiovascular health and neuroprotection have also been studied. Certificate ...

NAD

Peptide

Hot
product

NAD

NAD, also known as nicotinamide adenine dinucleotide, is an essential bioactive molecule in our body. Its main functions include: 1. NAD has significant anti-aging effects. As we age, the level of NAD in the human body gradually decreases, leading to accelerated cellular aging. Supplementing with NAD can effectively activate anti-aging mechanisms, delay cellular aging, and keep our bodies young. 2. NAD is crucial for enhancing energy. It participates in the energy production process of cellular mitochondria, helping us maintain abundant physical energy. When NAD levels are sufficient, we feel energized and able to cope with various challenges in daily life. 3. NAD can also promote cell repair. In daily life, our bodies are inevitably damaged, and NAD can help repair damaged cells and tissues, promoting physical recovery. 4. NAD can also improve cognitive function. By activating relevant proteins in brain cells, NAD can enhance memory, thinking ability, and concentration, making our brain more flexible and sharp. ...

Retatrutide

Peptide

Hot
product

Retatrutide

Sequence: Tyr-{Aib}-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile-{α-Me-Leu}-Leu-Asp-Lys-{doacod=C20-gamma-Glu-(AEEA)-Lys}-Ala-Gln-{Aib}-Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 Molecular Formula: C118H175N35O28 Molecular Weight: 2660.94 g/mol CAS Number: 2571941-83-5 PubChem CID: 145996114 Appearance: White powder Storage: Store in cool, dry and dark place，2-8°C Shelf Life: 2 Years Package: 5mg,10mg,15mg,1g,2g Certificate ...

BPC 157

Peptide

Hot
product

BPC 157

Common Name BPC 157 Density 1.4±0.1 g/cm3 Boiling Point 1802.9±65.0 °C at 760 mmHg Molecular Formula C62H98N16O22 Molecular Weight 1419.536 Flash Point 1044.2±34.3 °C Exact Mass 1418.704102 LogP -2.41 Vapour Pressure 0.0±0.6 mmHg at 25°C Index of Refraction 1.576 Certificate ...

Tirz

Peptide

Hot
product

Tirz

lt is a dual glucose-dependent insulinotropic polypeptide (GIPand glucagon-like peptide-1 (GLP-1) receptor agonist that is beingdeveloped for the treatment of type 2 diabetes. lt shows significantlybetter  efficacy with regard to glucose control. Thiscontent is provided strictly for research purposes and does not constitute anendorsement or  recommendation for the non-laboratoryapplication or improper handling of peptides designed for research. The information, including discussions about specific peptides and theirresearched benefits, is presented for informational purposes only and must notbe construed as health, clinical, or legal guidance, nor an encouragement fornon-research use in humans, Peptides described here are solely for use instructured scientific study by authorized individuals, Forresearch USE ONLY, Certificate ...

Cagrilintide

Peptide

Hot
product

Cagrilintide

Cagrelinide is a a cyclic peptide composed of 38 amino acids, with a sequence containing 38 amino acids and a pair of disulfide bonds. Kaglirin can significantly reduce weight and reduce food intake. Kagrelin peptide has potential in obesity research. As a non selective amino acid receptor (AMYR) and calcium G protein coupled receptor (CTR) advocate, Cagrinide is a new long acting acetylated amino acid analysis, which is a cyclic peptide composed of 38 amino acids The sequence contains a pair of defective bonds Cagritide can significantly reduce weight and food intake Cagritide has potential in objectivity research. Name ： Cagrilintide CAS： 1415456-99-3 Form： Powder EINECS： 206-141-6 Appearance: Powder Purity: >99% (or refer to the Certificate of Analysis) Shipping Condition: Shipped under ambient temperature as non-hazardous chemical. This product is stable enough for a few weeks during ordinary shipping and time spent in Customs. Storage Condition: Dry, dark and at 0 - 4 C for short term (days to weeks) or -20 C for long term (months to years). Solubility: To be determined Shelf Life: >2 years if stored properly Stock Solution Storage: 0 - 4 C for short term (days to weeks), or -20 C for long ...

Lipo-C

Peptide

Hot
product

Lipo-C

10 mL vial Amount per mL: Methionine 25mg Inositol 50mg Choline 50mg B6 (Pyridoxine) 25mg B5 (Dexpanthenol) 25mg B12 (Methylcobalamin)1mg  L-Carnitine 20mg L-Arginine 20mg 2% Benzyl Alcohol 2% Lidocaine  0.1% In sterile water 20 mL vial Amount per mL: Methionine 25mg Inositol 50mg Choline 50mg B1 (Thiamine HCL) 100 mg B6 (Pyridoxine) 25mg B5 (Dexpanthenol) 250 mg B12 (Methylcobalamin) 250 mcg L-Carnitine 600mg 2% Benzyl Alcohol 2% Lidocaine 0.1%" ...

GHK-CU

Peptide

Hot
product

GHK-CU

GHK-CU Certificate ...

Tesamorelin 10mg

Peptide

Hot
product

Tesamorelin 10mg

Tesamorelin, is a syntheitic peptide consiting of 44 amino acids. It is a growth-hormone-releasing hormone (GHRH) analogue researched for the treatment of HIV-associated lipodystrophy (dysfunctional, toxic fat deposition). It is also being researched for its ability to improve peripheral nerve health, slow the progression of mild cognitive impairment, and the reduction visceral fat. Certificate ...

TB 500

Peptide

Hot
product

TB 500

1. TB500 fragment has been shown to have the ability to promote the formation of blood vessels and to help repair damaged tissues. It also has anti-inflammatory properties and may help to reduce swelling and pain. Additionally, TB500 fragment has been found to stimulate stem cell production, which can lead to enhanced tissue regeneration. 2. TB500 fragment has the potential to be highly effective in treating a range of medical conditions, including chronic inflammation, heart disease, and skin wounds. It has also been found to be effective in reducing the severity of cardiovascular diseases, such as myocardial infarction and myocarditis. 3.TB500 is a synthetic version of an active region of thymosin β4. TB500 is claimed to promote endothelial cell differentiation, angiogenesis in dermal tissues, keratinocyte migration, collagen deposition and decrease inflammation. Certificate ...

PT 141

Peptide

Hot
product

PT 141

PT 141, also known as Bremelanotide, is a synthetic peptide developed for its unique properties related to sexual health and arousal. Originally derived from the peptide hormone Melanotan II, PT 141 is specifically designed to enhance libido in both men and women. Unlike other treatments that target the vascular system, PT 141 works directly through the nervous system, making it a distinct option for those seeking an alternative approach to sexual dysfunction. Certificate ...

AOD9604

Peptide

Hot
product

AOD9604

AOD 9604, also known as Anti-Obesity Drug 9604, is a synthetic peptide fragment derived from human growth hormone (HGH). Specifically, it consists of amino acids 176-191 of the C-terminus of the HGH molecule. This peptide has been extensively studied for its potential to promote weight loss and improve metabolic health. ...

If you have any questions please contact us

Contact Us
Customer Testimonials

What Our Guests Are Saying
About us

Adam Smith

Athens / Greece

Very professional, and the products look good. We sell very well in our market. Will come back soon!

Jaika Nur

Zagreb / Croatia

We cooperate from last year and many thanks for his trust. We'll provide high quality products for our business.

Maisa Marin

Moscow / Russia

The service is so nice, price is also good, the product itself came in the right time and quality is good.

OUR ADVANTAGES

Why Choose Us

  • Manufacturer

    The Source of Outstanding Manufacturing

  • Complete facilities

    All-round Hardware Guarantee

  • Product diversity

    Diverse Products for Your Free Choice

  • Support customization

    Customized Service with Quality Assurance

We are a professional manufacturer with a solid manufacturing foundation. Our production workshop is equipped with state-of-the-art equipment that adheres to high standards, ensuring precision and efficiency in every production process. Meanwhile, our team consists of a group of experienced production personnel who have been in the industry for years. They possess in-depth knowledge and skills, capable of handling various production tasks with excellence and bringing our products to life with top-notch quality.

Our factory is designed to meet all the requirements of modern production. It is furnished with standard production lines that follow strict industrial norms, enabling seamless and standardized manufacturing procedures. Besides, we have a wide range of production equipment, from advanced machinery for raw material processing to sophisticated tools for final assembly. This comprehensive equipment configuration guarantees that we can handle different production scales and complexities, providing a solid hardware foundation for the production of high-quality products.

We take pride in offering a vast array of products to meet the diverse needs of our customers. Whether it's different product specifications to fit specific usage scenarios, multiple models with various functions, or a wide variety of styles to match different aesthetic preferences, we have it all. And to ensure that you can get what you need promptly, we maintain a large stockpile of our products. So, no matter what your choice is, you can always be confident that we can deliver the right product to you in a timely manner.

We understand that every customer may have unique requirements, and that's why we wholeheartedly support customization. Our professional team is proficient in processing various specifications according to your specific demands. Whether it's customizing styles to make your product stand out or adapting to diverse technical specifications, we are committed to turning your ideas into reality. Moreover, throughout the customization process, we maintain strict quality control to ensure that the final customized products are not only unique but also of stable and reliable quality, giving you complete peace of mind when choosing our customized services.

  • upplied by manufacturers, the quality is guaranteed.

  • upplied by manufacturers, the quality is guaranteed.

  • upplied by manufacturers, the quality is guaranteed.

We'd love to hear from you if you have any questions!

Get In Touch

Our Blogs

Explore Our Latest News

Can Weight Loss Drugs Affect Your Fertility? A Woman’s Guide
Dec 29, 2016

Can Weight Loss Drugs Affect Your Fertility? A Woman’s Guide

read more
Getting the Most Out of Weight Loss Medications: Small Changes, Big Impact
Nov 19, 2016

Getting the Most Out of Weight Loss Medications: Small Changes, Big Impact

read more
Weight Loss Without the Burnout: Creating Habits That Actually Last
Jan 19, 2016

Weight Loss Without the Burnout: Creating Habits That Actually Last

read more
Go Back Top

Leave A Message

Happy to answer all your questions.