Welcome to Our Company
PeptiCore is a global man. ufacturer and supplier of peptides and pharmaceuticaraw materials in the chemical industry.
The mainproducts are peptide products and pharmaceuticalrawmaterials. We have strong R&D capabilities, superb synthesis technology, and advanced quality control methods. Effectively promote joint ventures and cooperationwith major enterprises and manufacturers, and servethe society and users with the concept of industrial de.velopment.We always adhere to market demand-oriented, and continuously synthesize new high-tech chemicaproducts and pharmaceutical intermediates.
l am veryconfident in the quality of our products, and many foreign customers will give high praise when they receiveour goods. Our products are of excellent quality, andwe firmly guarantee that your goods will be deliveredto your door. confident in the quality of our products. Many foreign customers will give high praise when theyreceive our goods.
Our products are of excelent qualityand we firmly guarantee that your goods will be deliv-ered to you door to door.q&a
Welcome to Our Company
OXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.
Appearance: Powder
Purity: >99% (or refer to the Certificate of Analysis)
Shipping Condition: Shipped under ambient temperature as non-hazardous chemical. This product is stable enough for a few weeks during ordinary shipping and time spent in Customs.
Storage Condition: Dry, dark and at 0 - 4 C for short term (days to weeks) or -20 C for long term (months to years).
Solubility: To be determined
Shelf Life: >2 years if stored properly
Quality First Safety Guaranteed

Send a Message
We'd love to hear from you if you have any questions!